LOC150763 polyclonal antibody
  • LOC150763 polyclonal antibody

LOC150763 polyclonal antibody

Ref: AB-PAB22729
LOC150763 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC150763.
Información adicional
Size 100 uL
Gene Name LOC150763
Gene Alias -
Gene Description hypothetical protein LOC150763
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HQKGVFLSQLLGEFSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LOC150763.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 150763
Iso type IgG

Enviar un mensaje


LOC150763 polyclonal antibody

LOC150763 polyclonal antibody