ARHGAP30 polyclonal antibody
  • ARHGAP30 polyclonal antibody

ARHGAP30 polyclonal antibody

Ref: AB-PAB22728
ARHGAP30 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARHGAP30.
Información adicional
Size 100 uL
Gene Name ARHGAP30
Gene Alias FLJ00267|FLJ44128
Gene Description Rho GTPase activating protein 30
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ANPCPRPGRLDGTPGERAWGSRASRSSWRNGGSLSFDAAVALARDRQRTEAQGVRRTQTCTEGGDYCLIPRTSPCSMISAHSPRPLSCLELPSEGAEGSGSRSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARHGAP30.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 257106
Iso type IgG

Enviar un mensaje


ARHGAP30 polyclonal antibody

ARHGAP30 polyclonal antibody