AZI2 polyclonal antibody
  • AZI2 polyclonal antibody

AZI2 polyclonal antibody

Ref: AB-PAB22724
AZI2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AZI2.
Información adicional
Size 100 uL
Gene Name AZI2
Gene Alias AZ2|NAP1|TILP
Gene Description 5-azacytidine induced 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AZI2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64343
Iso type IgG

Enviar un mensaje


AZI2 polyclonal antibody

AZI2 polyclonal antibody