MAP3K7IP3 polyclonal antibody
  • MAP3K7IP3 polyclonal antibody

MAP3K7IP3 polyclonal antibody

Ref: AB-PAB22722
MAP3K7IP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAP3K7IP3.
Información adicional
Size 100 uL
Gene Name MAP3K7IP3
Gene Alias MGC45404|NAP1|TAB3
Gene Description mitogen-activated protein kinase kinase kinase 7 interacting protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QPKPPFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAP3K7IP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 257397
Iso type IgG

Enviar un mensaje


MAP3K7IP3 polyclonal antibody

MAP3K7IP3 polyclonal antibody