FAM162A polyclonal antibody
  • FAM162A polyclonal antibody

FAM162A polyclonal antibody

Ref: AB-PAB22720
FAM162A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM162A.
Información adicional
Size 100 uL
Gene Name FAM162A
Gene Alias C3orf28|E2IG5|HGTD-P
Gene Description family with sequence similarity 162, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM162A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26355
Iso type IgG

Enviar un mensaje


FAM162A polyclonal antibody

FAM162A polyclonal antibody