COLEC11 polyclonal antibody
  • COLEC11 polyclonal antibody

COLEC11 polyclonal antibody

Ref: AB-PAB22718
COLEC11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COLEC11.
Información adicional
Size 100 uL
Gene Name COLEC11
Gene Alias CL-K1-I|CL-K1-II|CL-K1-IIa|CL-K1-IIb|CLK1|DKFZp686N1868|MGC3279
Gene Description collectin sub-family member 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COLEC11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 78989
Iso type IgG

Enviar un mensaje


COLEC11 polyclonal antibody

COLEC11 polyclonal antibody