PRRT3 polyclonal antibody
  • PRRT3 polyclonal antibody

PRRT3 polyclonal antibody

Ref: AB-PAB22717
PRRT3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRRT3.
Información adicional
Size 100 uL
Gene Name PRRT3
Gene Alias FLJ33674|MGC105134|MGC33990
Gene Description proline-rich transmembrane protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PLENSEIPMIPGAHPKGSVGSEPQAFDVFPENPRADSHRNSDVRHAPAEEMPEKPVASPLGPALYGPKAAQGAQRERLPVTDDLQMAQGPSSH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRRT3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285368
Iso type IgG

Enviar un mensaje


PRRT3 polyclonal antibody

PRRT3 polyclonal antibody