PID1 polyclonal antibody
  • PID1 polyclonal antibody

PID1 polyclonal antibody

Ref: AB-PAB22705
PID1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PID1.
Información adicional
Size 100 uL
Gene Name PID1
Gene Alias FLJ20701|HMFN2073|NYGGF4
Gene Description phosphotyrosine interaction domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PID1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55022
Iso type IgG

Enviar un mensaje


PID1 polyclonal antibody

PID1 polyclonal antibody