PRSS36 polyclonal antibody
  • PRSS36 polyclonal antibody

PRSS36 polyclonal antibody

Ref: AB-PAB22704
PRSS36 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRSS36.
Información adicional
Size 100 uL
Gene Name PRSS36
Gene Alias FLJ90661
Gene Description protease, serine, 36
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WVLGWKEPQDRVPVAAAVSILTQRICDCLYQGILPPGTLCVLYAEGQENRCEMTSAPPLLCQMTEGSWIPVGMAVQGSRELFAAIG
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRSS36.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146547
Iso type IgG

Enviar un mensaje


PRSS36 polyclonal antibody

PRSS36 polyclonal antibody