C1orf52 polyclonal antibody
  • C1orf52 polyclonal antibody

C1orf52 polyclonal antibody

Ref: AB-PAB22703
C1orf52 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf52.
Información adicional
Size 100 uL
Gene Name C1orf52
Gene Alias FLJ44982|RP11-234D19.1|gm117
Gene Description chromosome 1 open reading frame 52
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf52.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 148423
Iso type IgG

Enviar un mensaje


C1orf52 polyclonal antibody

C1orf52 polyclonal antibody