COMMD8 polyclonal antibody
  • COMMD8 polyclonal antibody

COMMD8 polyclonal antibody

Ref: AB-PAB22701
COMMD8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COMMD8.
Información adicional
Size 100 uL
Gene Name COMMD8
Gene Alias FLJ20502
Gene Description COMM domain containing 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COMMD8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54951
Iso type IgG

Enviar un mensaje


COMMD8 polyclonal antibody

COMMD8 polyclonal antibody