OLA1 polyclonal antibody
  • OLA1 polyclonal antibody

OLA1 polyclonal antibody

Ref: AB-PAB22696
OLA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OLA1.
Información adicional
Size 100 uL
Gene Name OLA1
Gene Alias DKFZp313H1942|GTPBP9|PTD004
Gene Description Obg-like ATPase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFED
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OLA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29789
Iso type IgG

Enviar un mensaje


OLA1 polyclonal antibody

OLA1 polyclonal antibody