HDDC2 polyclonal antibody
  • HDDC2 polyclonal antibody

HDDC2 polyclonal antibody

Ref: AB-PAB22692
HDDC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HDDC2.
Información adicional
Size 100 uL
Gene Name HDDC2
Gene Alias C6orf74|CGI-130|MGC87330|NS5ATP2|dJ167O5.2
Gene Description HD domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MASVSSATFSGHGARSLLQFLLLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HDDC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51020
Iso type IgG

Enviar un mensaje


HDDC2 polyclonal antibody

HDDC2 polyclonal antibody