C9orf66 polyclonal antibody
  • C9orf66 polyclonal antibody

C9orf66 polyclonal antibody

Ref: AB-PAB22691
C9orf66 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf66.
Información adicional
Size 100 uL
Gene Name C9orf66
Gene Alias FLJ31158|RP11-59O6.1
Gene Description chromosome 9 open reading frame 66
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPRRLRTSRSTEILGEDLAGPSAGAAARPAAPPPQPREPGA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf66.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 157983
Iso type IgG

Enviar un mensaje


C9orf66 polyclonal antibody

C9orf66 polyclonal antibody