GABRG1 polyclonal antibody
  • GABRG1 polyclonal antibody

GABRG1 polyclonal antibody

Ref: AB-PAB22690
GABRG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GABRG1.
Información adicional
Size 100 uL
Gene Name GABRG1
Gene Alias DKFZp686H2042|MGC33838
Gene Description gamma-aminobutyric acid (GABA) A receptor, gamma 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GABRG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2565
Iso type IgG

Enviar un mensaje


GABRG1 polyclonal antibody

GABRG1 polyclonal antibody