RASGEF1A polyclonal antibody
  • RASGEF1A polyclonal antibody

RASGEF1A polyclonal antibody

Ref: AB-PAB22688
RASGEF1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RASGEF1A.
Información adicional
Size 100 uL
Gene Name RASGEF1A
Gene Alias CG4853|FLJ37817
Gene Description RasGEF domain family, member 1A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HIELDRVSSIYPEDLMQIVSHMDSLDNHRCRGDLTKTYSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RASGEF1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221002
Iso type IgG

Enviar un mensaje


RASGEF1A polyclonal antibody

RASGEF1A polyclonal antibody