SLC35A5 polyclonal antibody
  • SLC35A5 polyclonal antibody

SLC35A5 polyclonal antibody

Ref: AB-PAB22687
SLC35A5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC35A5.
Información adicional
Size 100 uL
Gene Name SLC35A5
Gene Alias DKFZp434E102|FLJ11130|FLJ20730|FLJ25973
Gene Description solute carrier family 35, member A5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TLQHNLAGRGFHHDAFFSPSNSCLLFRSECPRKDNCTAKEWTFPEAKWNTTARV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC35A5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55032
Iso type IgG

Enviar un mensaje


SLC35A5 polyclonal antibody

SLC35A5 polyclonal antibody