RFX7 polyclonal antibody
  • RFX7 polyclonal antibody

RFX7 polyclonal antibody

Ref: AB-PAB22684
RFX7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RFX7.
Información adicional
Size 100 uL
Gene Name RFX7
Gene Alias FLJ12994|FLJ21104|MGC131836|RFXDC2
Gene Description regulatory factor X, 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VVTQHMQSVKQAPKTPQNVPASPGGDRSARHRYPQILPKPANTSALTIRSPTTVLFTSSPIKTAVVPASHMSSLNVVKMTTISLTPSNSNTPLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RFX7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64864
Iso type IgG

Enviar un mensaje


RFX7 polyclonal antibody

RFX7 polyclonal antibody