MTHFD2L polyclonal antibody
  • MTHFD2L polyclonal antibody

MTHFD2L polyclonal antibody

Ref: AB-PAB22683
MTHFD2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MTHFD2L.
Información adicional
Size 100 uL
Gene Name MTHFD2L
Gene Alias FLJ13105|MGC45532|MGC72244
Gene Description methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTI
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MTHFD2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 441024
Iso type IgG

Enviar un mensaje


MTHFD2L polyclonal antibody

MTHFD2L polyclonal antibody