THNSL2 polyclonal antibody
  • THNSL2 polyclonal antibody

THNSL2 polyclonal antibody

Ref: AB-PAB22681
THNSL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THNSL2.
Información adicional
Size 100 uL
Gene Name THNSL2
Gene Alias FLJ10916|THS2|TSH2
Gene Description threonine synthase-like 2 (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human THNSL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55258
Iso type IgG

Enviar un mensaje


THNSL2 polyclonal antibody

THNSL2 polyclonal antibody