RASA2 polyclonal antibody
  • RASA2 polyclonal antibody

RASA2 polyclonal antibody

Ref: AB-PAB22679
RASA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RASA2.
Información adicional
Size 100 uL
Gene Name RASA2
Gene Alias GAP1M
Gene Description RAS p21 protein activator 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq PDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RASA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5922
Iso type IgG

Enviar un mensaje


RASA2 polyclonal antibody

RASA2 polyclonal antibody