CCDC14 polyclonal antibody
  • CCDC14 polyclonal antibody

CCDC14 polyclonal antibody

Ref: AB-PAB22673
CCDC14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC14.
Información adicional
Size 100 uL
Gene Name CCDC14
Gene Alias DKFZp434L1050|FLJ12892|FLJ41065
Gene Description coiled-coil domain containing 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IIYQALCEHVQTQMSLMNDLTSKNIPNGIPAVPCHAPSHSESQATPHSSYGLCTSTPVWSLQRPPCPPKVHSEVQTDGNSQFASQG
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64770
Iso type IgG

Enviar un mensaje


CCDC14 polyclonal antibody

CCDC14 polyclonal antibody