FSTL1 polyclonal antibody
  • FSTL1 polyclonal antibody

FSTL1 polyclonal antibody

Ref: AB-PAB22672
FSTL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FSTL1.
Información adicional
Size 100 uL
Gene Name FSTL1
Gene Alias FLJ50214|FLJ52277|FRP|FSL1
Gene Description follistatin-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FSTL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11167
Iso type IgG

Enviar un mensaje


FSTL1 polyclonal antibody

FSTL1 polyclonal antibody