RFTN2 polyclonal antibody
  • RFTN2 polyclonal antibody

RFTN2 polyclonal antibody

Ref: AB-PAB22670
RFTN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RFTN2.
Información adicional
Size 100 uL
Gene Name RFTN2
Gene Alias C2orf11|FLJ30574|MGC117313|Raftlin-2
Gene Description raftlin family member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NVAAKRGMKFVGFISQHYSPSKFCNGTNHDGDIESMLHVRHGSDENCRSWNEGTLSGQSSESGIEEELHHESGQYQMEQNGSPTSSKSRKGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RFTN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 130132
Iso type IgG

Enviar un mensaje


RFTN2 polyclonal antibody

RFTN2 polyclonal antibody