DNAJC9 polyclonal antibody
  • DNAJC9 polyclonal antibody

DNAJC9 polyclonal antibody

Ref: AB-PAB22669
DNAJC9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJC9.
Información adicional
Size 100 uL
Gene Name DNAJC9
Gene Alias HDJC9|JDD1|KIAA0974|SB73
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYT
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJC9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23234
Iso type IgG

Enviar un mensaje


DNAJC9 polyclonal antibody

DNAJC9 polyclonal antibody