ZNF641 polyclonal antibody
  • ZNF641 polyclonal antibody

ZNF641 polyclonal antibody

Ref: AB-PAB22667
ZNF641 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF641.
Información adicional
Size 100 uL
Gene Name ZNF641
Gene Alias DKFZp667D1012|FLJ31295
Gene Description zinc finger protein 641
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq EDRSQFGSAAEMLSEQTAALGTGWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEHLCCDLEEEPQSLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEW
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF641.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 121274
Iso type IgG

Enviar un mensaje


ZNF641 polyclonal antibody

ZNF641 polyclonal antibody