SLC25A43 polyclonal antibody
  • SLC25A43 polyclonal antibody

SLC25A43 polyclonal antibody

Ref: AB-PAB22666
SLC25A43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC25A43.
Información adicional
Size 100 uL
Gene Name SLC25A43
Gene Alias -
Gene Description solute carrier family 25, member 43
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC25A43.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 203427
Iso type IgG

Enviar un mensaje


SLC25A43 polyclonal antibody

SLC25A43 polyclonal antibody