GOLGA4 polyclonal antibody
  • GOLGA4 polyclonal antibody

GOLGA4 polyclonal antibody

Ref: AB-PAB22660
GOLGA4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GOLGA4.
Información adicional
Size 100 uL
Gene Name GOLGA4
Gene Alias GCP2|GOLG|MU-RMS-40.18|p230
Gene Description golgi autoantigen, golgin subfamily a, 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NLLKEELDQQNKRFDCLKGEMEDDKSKMEKKESNLETELKSQTARIMELEDHITQKTIEIESLNEVLKNYNQQKDIEHKELVQKLQHFQELGEEKDNRVKEAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GOLGA4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2803
Iso type IgG

Enviar un mensaje


GOLGA4 polyclonal antibody

GOLGA4 polyclonal antibody