C14orf166B polyclonal antibody
  • C14orf166B polyclonal antibody

C14orf166B polyclonal antibody

Ref: AB-PAB22659
C14orf166B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C14orf166B.
Información adicional
Size 100 uL
Gene Name C14orf166B
Gene Alias -
Gene Description chromosome 14 open reading frame 166B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLTNPMKLIQSYADQHKITIVDFFKSLNPTGTMKMSVDEFQKVMIEQNKVPLNQYQVREVIKKLDEKTGMVNFSFLNTMK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C14orf166B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 145497
Iso type IgG

Enviar un mensaje


C14orf166B polyclonal antibody

C14orf166B polyclonal antibody