ZCWPW2 polyclonal antibody
  • ZCWPW2 polyclonal antibody

ZCWPW2 polyclonal antibody

Ref: AB-PAB22654
ZCWPW2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZCWPW2.
Información adicional
Size 100 uL
Gene Name ZCWPW2
Gene Alias ZCW2
Gene Description zinc finger, CW type with PWWP domain 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZCWPW2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 152098
Iso type IgG

Enviar un mensaje


ZCWPW2 polyclonal antibody

ZCWPW2 polyclonal antibody