KLHL18 polyclonal antibody
  • KLHL18 polyclonal antibody

KLHL18 polyclonal antibody

Ref: AB-PAB22653
KLHL18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KLHL18.
Información adicional
Size 100 uL
Gene Name KLHL18
Gene Alias FLJ13703|FLJ61265|KIAA0795
Gene Description kelch-like 18 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EAKDYHLMPERRPHLPAFRTRPRCCTSIAGLIYAVGGLNSAGDSLNVVEVFDPIANCWERCRPMTTARSRVGVAVVNGL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLHL18.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23276
Iso type IgG

Enviar un mensaje


KLHL18 polyclonal antibody

KLHL18 polyclonal antibody