PCNP polyclonal antibody
  • PCNP polyclonal antibody

PCNP polyclonal antibody

Ref: AB-PAB22650
PCNP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PCNP.
Información adicional
Size 100 uL
Gene Name PCNP
Gene Alias DKFZp781I24156
Gene Description PEST proteolytic signal containing nuclear protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PCNP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57092
Iso type IgG

Enviar un mensaje


PCNP polyclonal antibody

PCNP polyclonal antibody