AFTPH polyclonal antibody
  • AFTPH polyclonal antibody

AFTPH polyclonal antibody

Ref: AB-PAB22647
AFTPH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AFTPH.
Información adicional
Size 100 uL
Gene Name AFTPH
Gene Alias FLJ20080|FLJ23793|MGC33965|Nbla10388
Gene Description aftiphilin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RENNKINRVNELNSVKEVALGRSLDNKGDTDGEDQVCVSEISIVTNRGFSVEKQGLPTLQQDEFLQSGVQSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AFTPH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54812
Iso type IgG

Enviar un mensaje


AFTPH polyclonal antibody

AFTPH polyclonal antibody