MCART6 polyclonal antibody
  • MCART6 polyclonal antibody

MCART6 polyclonal antibody

Ref: AB-PAB22643
MCART6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MCART6.
Información adicional
Size 100 uL
Gene Name MCART6
Gene Alias DKFZp686O1267
Gene Description mitochondrial carrier triple repeat 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MQSHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRSSVTWGLTTAIHDFLQRKSHSRKELKTD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MCART6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 401612
Iso type IgG

Enviar un mensaje


MCART6 polyclonal antibody

MCART6 polyclonal antibody