TFPT polyclonal antibody
  • TFPT polyclonal antibody

TFPT polyclonal antibody

Ref: AB-PAB22642
TFPT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TFPT.
Información adicional
Size 100 uL
Gene Name TFPT
Gene Alias FB1|INO80F|amida
Gene Description TCF3 (E2A) fusion partner (in childhood Leukemia)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQFTIVLEDEGSQGTDAPTPGNAENEPPEKETLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TFPT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29844
Iso type IgG

Enviar un mensaje


TFPT polyclonal antibody

TFPT polyclonal antibody