ZNF793 polyclonal antibody
  • ZNF793 polyclonal antibody

ZNF793 polyclonal antibody

Ref: AB-PAB22639
ZNF793 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF793.
Información adicional
Size 100 uL
Gene Name ZNF793
Gene Alias -
Gene Description zinc finger protein 793
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NHNLDLIGFKRNCAKKQDECYAYGKLLQRINHGRRPNGEKPRGCSHCEKAFTQNPALMYKPAVSDSLLYKRKRVPPTE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF793.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 390927
Iso type IgG

Enviar un mensaje


ZNF793 polyclonal antibody

ZNF793 polyclonal antibody