ADAMTSL3 polyclonal antibody
  • ADAMTSL3 polyclonal antibody

ADAMTSL3 polyclonal antibody

Ref: AB-PAB22637
ADAMTSL3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ADAMTSL3.
Información adicional
Size 100 uL
Gene Name ADAMTSL3
Gene Alias KIAA1233|MGC150716|MGC150717
Gene Description ADAMTS-like 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ALREPMREYPGMDHSEANSLGVTWHKMRQMWNNKNDLYLDDDHISNQPFLRALLGHCSNSAGSTNSWELKNKQFEAAVKQGAYSMDTAQFDELIR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ADAMTSL3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57188
Iso type IgG

Enviar un mensaje


ADAMTSL3 polyclonal antibody

ADAMTSL3 polyclonal antibody