LBH polyclonal antibody
  • LBH polyclonal antibody

LBH polyclonal antibody

Ref: AB-PAB22634
LBH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LBH.
Información adicional
Size 100 uL
Gene Name LBH
Gene Alias DKFZp566J091|MGC104312|MGC163287
Gene Description limb bud and heart development homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETAKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LBH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81606
Iso type IgG

Enviar un mensaje


LBH polyclonal antibody

LBH polyclonal antibody