SCGB2A1 polyclonal antibody
  • SCGB2A1 polyclonal antibody

SCGB2A1 polyclonal antibody

Ref: AB-PAB22625
SCGB2A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCGB2A1.
Información adicional
Size 100 uL
Gene Name SCGB2A1
Gene Alias LPHC|MGB2|MGC71973|UGB3
Gene Description secretoglobin, family 2A, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCGB2A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4246
Iso type IgG

Enviar un mensaje


SCGB2A1 polyclonal antibody

SCGB2A1 polyclonal antibody