TTLL5 polyclonal antibody
  • TTLL5 polyclonal antibody

TTLL5 polyclonal antibody

Ref: AB-PAB22614
TTLL5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTLL5.
Información adicional
Size 100 uL
Gene Name TTLL5
Gene Alias KIAA0998|MGC117189|STAMP
Gene Description tubulin tyrosine ligase-like family, member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NKHHSGIAKTQKEGEDASLYSKRYNQSMVTAELQRLAEKQAARQYSPSSHINLLTQQVTNLNLATGIINRSSASAPPTLRPIISPSGP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTLL5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23093
Iso type IgG

Enviar un mensaje


TTLL5 polyclonal antibody

TTLL5 polyclonal antibody