FAM161A polyclonal antibody
  • FAM161A polyclonal antibody

FAM161A polyclonal antibody

Ref: AB-PAB22612
FAM161A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM161A.
Información adicional
Size 100 uL
Gene Name FAM161A
Gene Alias FLJ13305|MGC129982|MGC129983
Gene Description family with sequence similarity 161, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KSPKLLTVCKPFDLHASPHASIKREKILADIEADEENLKETRWPYLSPRRKSPVRCAGVNPVPCNCNPPVPTVSSRGREQAVRKSEKERMR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM161A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84140
Iso type IgG

Enviar un mensaje


FAM161A polyclonal antibody

FAM161A polyclonal antibody