NAV3 polyclonal antibody
  • NAV3 polyclonal antibody

NAV3 polyclonal antibody

Ref: AB-PAB22610
NAV3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NAV3.
Información adicional
Size 100 uL
Gene Name NAV3
Gene Alias KIAA0938|POMFIL1|STEERIN3|unc53H3
Gene Description neuron navigator 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq STDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKASLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NAV3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 89795
Iso type IgG

Enviar un mensaje


NAV3 polyclonal antibody

NAV3 polyclonal antibody