EXOC2 polyclonal antibody
  • EXOC2 polyclonal antibody

EXOC2 polyclonal antibody

Ref: AB-PAB22609
EXOC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EXOC2.
Información adicional
Size 100 uL
Gene Name EXOC2
Gene Alias FLJ11026|SEC5|SEC5L1|Sec5p
Gene Description exocyst complex component 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EXOC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55770
Iso type IgG

Enviar un mensaje


EXOC2 polyclonal antibody

EXOC2 polyclonal antibody