TRNAU1AP polyclonal antibody
  • TRNAU1AP polyclonal antibody

TRNAU1AP polyclonal antibody

Ref: AB-PAB22608
TRNAU1AP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRNAU1AP.
Información adicional
Size 100 uL
Gene Name TRNAU1AP
Gene Alias FLJ20503|PRO1902|RP4-669K10.4|SECP43|TRSPAP1
Gene Description tRNA selenocysteine 1 associated protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRNAU1AP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54952
Iso type IgG

Enviar un mensaje


TRNAU1AP polyclonal antibody

TRNAU1AP polyclonal antibody