KLHDC9 polyclonal antibody
  • KLHDC9 polyclonal antibody

KLHDC9 polyclonal antibody

Ref: AB-PAB22607
KLHDC9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KLHDC9.
Información adicional
Size 100 uL
Gene Name KLHDC9
Gene Alias KARCA1|MGC33338|RP11-544M22.9
Gene Description kelch domain containing 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VDGRWLCVVGGWDGSRRLATVTALDTERGVWEAWTGTPGDCPPAGLSSHTCTRISDRELQVAGREGGIHTQRRYGSIYTLRLDPSARTY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLHDC9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126823
Iso type IgG

Enviar un mensaje


KLHDC9 polyclonal antibody

KLHDC9 polyclonal antibody