CACNA2D4 polyclonal antibody
  • CACNA2D4 polyclonal antibody

CACNA2D4 polyclonal antibody

Ref: AB-PAB22598
CACNA2D4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CACNA2D4.
Información adicional
Size 100 uL
Gene Name CACNA2D4
Gene Alias RCD4
Gene Description calcium channel, voltage-dependent, alpha 2/delta subunit 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NDFINIIAYNDYVHYIEPCFKGILVQADRDNREHFKLLVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLCNQAIM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CACNA2D4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93589
Iso type IgG

Enviar un mensaje


CACNA2D4 polyclonal antibody

CACNA2D4 polyclonal antibody