GLT25D2 polyclonal antibody
  • GLT25D2 polyclonal antibody

GLT25D2 polyclonal antibody

Ref: AB-PAB22584
GLT25D2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GLT25D2.
Información adicional
Size 100 uL
Gene Name GLT25D2
Gene Alias C1orf17|FLJ37771|FLJ37873|KIAA0584
Gene Description glycosyltransferase 25 domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AFSSRQAGIQMYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GLT25D2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23127
Iso type IgG

Enviar un mensaje


GLT25D2 polyclonal antibody

GLT25D2 polyclonal antibody