FAM135A polyclonal antibody
  • FAM135A polyclonal antibody

FAM135A polyclonal antibody

Ref: AB-PAB22583
FAM135A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM135A.
Información adicional
Size 100 uL
Gene Name FAM135A
Gene Alias DKFZp781H2319|FLJ13577|KIAA1411
Gene Description family with sequence similarity 135, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ISQDDSEITQMEHNLASRRSSDDCHDHQTTPSLGVRTIEIKPSNKDPFSGENITVKLGPWTELRQEEILVDNLLPNFESLESNGKSKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM135A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57579
Iso type IgG

Enviar un mensaje


FAM135A polyclonal antibody

FAM135A polyclonal antibody