SPOCD1 polyclonal antibody
  • SPOCD1 polyclonal antibody

SPOCD1 polyclonal antibody

Ref: AB-PAB22580
SPOCD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPOCD1.
Información adicional
Size 100 uL
Gene Name SPOCD1
Gene Alias FLJ25348|FLJ39908|RP11-84A19.1
Gene Description SPOC domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SPLLSPGLEVTHSSLLLAVLLPKEGLPDTAGSSPWLGKVQKMVSFNSKVEKRYYQPDDRRPNVPLKGTPPPGGAWQQSQGRGSIAPRGISA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPOCD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90853
Iso type IgG

Enviar un mensaje


SPOCD1 polyclonal antibody

SPOCD1 polyclonal antibody