TMEM209 polyclonal antibody
  • TMEM209 polyclonal antibody

TMEM209 polyclonal antibody

Ref: AB-PAB22576
TMEM209 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM209.
Información adicional
Size 100 uL
Gene Name TMEM209
Gene Alias FLJ14803|NET31
Gene Description transmembrane protein 209
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq APCANKDEADLSSKQAAEEVWARVAMNRQLLDHMDSWTAKFRNWINETILVPLVQEIESVSTQMRRMGCPELQIGEASITSLKQAALVKAPLIPTLNTIVQYLDLTPNQEYLFERIKELSQGGCMSSFRWNRGGDFKGRKWDTD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM209.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84928
Iso type IgG

Enviar un mensaje


TMEM209 polyclonal antibody

TMEM209 polyclonal antibody